Structure of PDB 7y8a Chain L

Receptor sequence

>7y8aL (length=147) Species: 173977 (Chroomonas placoidea) [Search protein sequence]

QFVKPYNDDPFVGNLATPVSTSSFTRSFLSNLPAYRSGLSPLLRGLEIGM
THGYFLVGPFYKLGPLRNSDVALISGLFSSIGLIIILAACLAIYGVVSFN
EDDNTDSLQTSRGWKQFTSGWLVGSIGGASFAYILISNIVFLQTSGL

3D structure

PDB

7y8a Structural basis and evolution of the photosystem I-light-harvesting supercomplex of cryptophyte algae.

Chain

Resolution

2.71 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	T19 V21 F30	T17 V19 F28
BS02	CLA	L	P61 F62 L65 P67	P59 F60 L63 P65
BS03	CLA	L	P67 L68 S77 F80 I88	P65 L66 S75 F78 I86
BS04	CLA	L	N33 L34 R38 E49 T53	N31 L32 R36 E47 T51
BS05	CLA	L	V21 P35 A36 I50 T53 H54 F57	V19 P33 A34 I48 T51 H52 F55
BS06	CLA	L	Y56 F57 G60 P61 K64 L137 I138 L144 S147	Y54 F55 G58 P59 K62 L135 I136 L142 S145
BS07	IHT	L	H54 C92 L93 Y96 W123	H52 C90 L91 Y94 W121
BS08	8CT	L	M52 Y56 G129 F133	M50 Y54 G127 F131

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009536	plastid
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

External links