Structure of PDB 7vot Chain L

Receptor sequence

>7votL (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

PDB

7vot Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	L	F97 A124 L131 W156 V157 T160 Y162 F167 H168 H173 I177 F180 F181 S244 M248	F97 A124 L131 W156 V157 T160 Y162 F167 H168 H173 I177 F180 F181 S244 M248
BS02	BCL	L	Y128 L131 F146 I150 W151 H153 L154	Y128 L131 F146 I150 W151 H153 L154
BS03	BPB	L	A42 I46 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241	A42 I46 A93 F97 W100 E104 A120 F121 A124 Y148 G149 H153 V241
BS04	U10	L	F179 T182 L189 H190 L193 D213 F216 S223 I224 G225 I229 L232 F243	F179 T182 L189 H190 L193 D213 F216 S223 I224 G225 I229 L232 F243
BS05	U10	L	P171 M174 I175 W255 W262 W263	P171 M174 I175 W255 W262 W263
BS06	BCL	L	H168 M174 I177 S178 F181 T182	H168 M174 I177 S178 F181 T182
BS07	FE2	L	H190 H230	H190 H230
BS08	BPB	L	F181 L185 L189	F181 L185 L189
BS09	U10	L	F29 G35 F39 W100	F29 G35 F39 W100

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7vot, PDBe:7vot, PDBj:7vot
PDBsum	7vot
PubMed	35418573
UniProt	Q3J1A5\|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]