Structure of PDB 7vb9 Chain L

Receptor sequence

>7vb9L (length=268) Species: 272943 (Cereibacter sphaeroides 2.4.1)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVK

3D structure

• PDB: 7vb9 Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
• Chain: L
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 H168 H173 I177 F180 S244 M248	F97 H168 H173 I177 F180 S244 M248
BS02	BCL	L	Y128 L131 F146 I150 W151 H153 L154	Y128 L131 F146 I150 W151 H153 L154
BS03	BPH	L	A96 F97 E104 F121 Y148 V241	A96 F97 E104 F121 Y148 V241
BS04	U10	L	S178 T182 L189 H190 L193 P209 E212 D213 F216 S223 I224 G225 I229	S178 T182 L189 H190 L193 P209 E212 D213 F216 S223 I224 G225 I229
BS05	BCL	L	H168 M174 I177 S178	H168 M174 I177 S178
BS06	BPH	L	F181 L185 L189	F181 L185 L189
BS07	FE2	L	H190 H230	H190 H230
BS08	U10	L	G35 F39	G35 F39

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7vb9, PDBe:7vb9, PDBj:7vb9
• PDBsum: 7vb9
• PubMed: 35418573
• UniProt: Q3J1A5|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)