Structure of PDB 7v2o Chain L

Receptor sequence

>7v2oL (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 7v2o Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
• Chain: L
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P2 N5 Q6 R9 R12 E13 K14 K18 A27 P28 F29 R30 R31 R38 P42 K43 K44 N46 S47 A48 L49 R50 K51 T58 G69 E70 L81 G84 K88 D89 P91 R94 R110 K111 K112 S113 R114 S115 K116 Y117 T119 K120 K121	P1 N4 Q5 R8 R11 E12 K13 K17 A26 P27 F28 R29 R30 R37 P41 K42 K43 N45 S46 A47 L48 R49 K50 T57 G68 E69 L80 G83 K87 D88 P90 R93 R109 K110 K111 S112 R113 S114 K115 Y116 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7v2o, PDBe:7v2o, PDBj:7v2o
• PDBsum: 7v2o
• PubMed: 35316014
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)