Structure of PDB 7uw1 Chain L

Receptor sequence

>7uw1L (length=137) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTARQIEAA
RRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPG
KILYEIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM

3D structure

PDB

7uw1 Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	K5 R6 K8 F9 R10 K11 V12 H13 K14 G15 R16 R23 G24 R45 Q46 R56 R67 F69 K77 E80 R82 M83 G84 N85 G86 K87 A123 K124 P126 K128	K5 R6 K8 F9 R10 K11 V12 H13 K14 G15 R16 R23 G24 R45 Q46 R56 R67 F69 K77 E80 R82 M83 G84 N85 G86 K87 A123 K124 P126 K128
BS02	rna	L	G19 R39	G19 R39

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uw1, PDBe:7uw1, PDBj:7uw1
PDBsum	7uw1
PubMed	37192172
UniProt	B7IA32\|RL16_ACIB5 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]