Structure of PDB 7u0i Chain L

Receptor sequence
>7u0iL (length=75) Species: 9606,83333 [Search protein sequence]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNN
3D structure
PDB7u0i Structural mechanism of LIN28B nucleosome targeting by OCT4.
ChainL
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna L T182 R186 T43 R47
BS02 dna L R157 T163 Q164 Q181 T182 C185 R18 T24 Q25 Q42 T43 C46
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0015144 carbohydrate transmembrane transporter activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008643 carbohydrate transport
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7u0i, PDBe:7u0i, PDBj:7u0i
PDBsum7u0i
PubMed37327775
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]