Structure of PDB 7s3d Chain L

Receptor sequence

>7s3dL (length=170) Species: 91464 (Synechococcus sp. PCC 7335) [Search protein sequence]

SDAYISDDPIQPYQGNPQLGNLATPINSSNLAKAFINNLPAYRPGLTPFL
RGLEIGMAHGYFLVGPEVVFGPLKEGSHGANLSGLITAIYITVSACLGIS
IFALATFQGDPRGTYNSHSRDRLRPLRKKEDWYQLSGGILMGSLGGAIFA
YALLENFELLDSILRGAVNV

3D structure

PDB

7s3d Structure of a photosystem I-ferredoxin complex from a marine cyanobacterium provides insights into far-red light photoacclimation.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	I13 T27 I29	I10 T24 I26
BS02	CLA	L	T27 I29 N30	T24 I26 N27
BS03	CLA	L	P69 E70 F73 P75	P66 E67 F70 P72
BS04	F6C	L	E70 P75 I89	E67 P72 I86
BS05	F6C	L	H62 F105	H59 F102
BS06	CA	L	P75 E78	P72 E75
BS07	CLA	L	N41 R46 E57 M60 A61	N38 R43 E54 M57 A58
BS08	CLA	L	F38 P43 A44 I58 H62 F65	F35 P40 A41 I55 H59 F62
BS09	CLA	L	Y64 F65 G68 P69 V72 F73 L156 L157 F160	Y61 F62 G65 P66 V69 F70 L153 L154 F157
BS10	CLA	L	L100 S103	L97 S100

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7s3d, PDBe:7s3d, PDBj:7s3d
PDBsum	7s3d
PubMed	34793839
UniProt	B4WP22

[Back to BioLiP]