Structure of PDB 7ryh Chain L

Receptor sequence
>7ryhL (length=137) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTARQIEAA
RRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPG
KILYEIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM
3D structure
PDB7ryh An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
ChainL
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L K5 R6 K8 F9 H13 K14 R16 R23 G24 Q46 F69 E80 R82 M83 G84 N85 G86 K87 K124 P126 K128 K5 R6 K8 F9 H13 K14 R16 R23 G24 Q46 F69 E80 R82 M83 G84 N85 G86 K87 K124 P126 K128
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryh, PDBe:7ryh, PDBj:7ryh
PDBsum7ryh
PubMed35100868
UniProtB7IA32|RL16_ACIB5 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]