Structure of PDB 7qxs Chain L |
>7qxsL (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
RSSRAGLQFPVGRVRRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELA GNAARDNKKTRIIPRHLQLAIRNDEELNKLLG |
|
PDB | 7qxs Structural basis of human telomerase recruitment by TPP1-POT1. |
Chain | L |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
L |
R33 R43 K76 R78 |
R16 R26 K59 R61 |
|
|
|
|