Structure of PDB 7qwr Chain L

Receptor sequence

>7qwrL (length=210) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

APSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQARARRIAPRPA
SGPLRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPR
RRNKSTESLQANVQRLKEYRSKLVLFPRKPSAPKKGDSSAEELKLATQLT
GPVMPIRNVFKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKE
AAEQDVEKKK

3D structure

PDB

7qwr Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	A2 R5 M8 L10 K11 H13 F14 H15 K16 W18 R20 W25 Q28 P29 R31 K32 R35 R36 R39 R42 R44 R56 V59 R60 P62 T63 Y66 H67 R71 G73 R74 L78 H87 K88 K89 R92 P100 R101 R102 R103 K105 S106 R129 F179 R183 R186 N188 G193 K197 R198	A1 R4 M7 L9 K10 H12 F13 H14 K15 W17 R19 W24 Q27 P28 R30 K31 R34 R35 R38 R41 R43 R55 V58 R59 P61 T62 Y65 H66 R70 G72 R73 L77 H86 K87 K88 R91 P99 R100 R101 R102 K104 S105 R128 F178 R182 R185 N187 G192 K196 R197
BS02	rna	L	N27 A30 R34	N26 A29 R33

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qwr, PDBe:7qwr, PDBj:7qwr
PDBsum	7qwr
PubMed	35201867
UniProt	G1TKB3\|RL13_RABIT Large ribosomal subunit protein eL13 (Gene Name=RPL13)

[Back to BioLiP]