Structure of PDB 7q7n Chain L

Receptor sequence

>7q7nL (length=280) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAITFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGIN

3D structure

• PDB: 7q7n Towards automated crystallographic structure refinement with phenix.refine.
• Chain: L
• Resolution: 2.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	L	I49 A93 W100 E104 A120 F121 A124 Y148 V241	I49 A93 W100 E104 A120 F121 A124 Y148 V241
BS02	BCL	L	F146 H153 L154	F146 H153 L154
BS03	BCL	L	F97 A124 I125 A127 L131 V157 T160 F167 H168 H173 I177 F180 S244 M248	F97 A124 I125 A127 L131 V157 T160 F167 H168 H173 I177 F180 S244 M248
BS04	BPH	L	F181 L185 L189	F181 L185 L189
BS05	UQ7	L	F29 G35	F29 G35
BS06	BCL	L	H168 M174 I177 T182	H168 M174 I177 T182
BS07	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7q7n, PDBe:7q7n, PDBj:7q7n
• PDBsum: 7q7n
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)