Structure of PDB 7q7h Chain L

Receptor sequence

>7q7hL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAITFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 7q7h Towards automated crystallographic structure refinement with phenix.refine.
• Chain: L
• Resolution: 2.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	L	W100 E104 A120 F121 A124 Y148 V241	W100 E104 A120 F121 A124 Y148 V241
BS02	BCL	L	F146 I150 H153 L154	F146 I150 H153 L154
BS03	BCL	L	F97 A124 I125 V157 S158 T160 Y162 F167 H168 H173 I177 F180 S244 A245 M248	F97 A124 I125 V157 S158 T160 Y162 F167 H168 H173 I177 F180 S244 A245 M248
BS04	UQ7	L	F29 W100	F29 W100
BS05	BCL	L	H168 M174 I177 T178 T182	H168 M174 I177 T178 T182
BS06	BPH	L	F181 L185 L189	F181 L185 L189
BS07	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7q7h, PDBe:7q7h, PDBj:7q7h
• PDBsum: 7q7h
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)