Structure of PDB 7pil Chain L

Receptor sequence

>7pilL (length=281) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

PDB

7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	L	I49 W100 E104 A120 F121 A124 Y148 G149 I150 H153 V241	I49 W100 E104 A120 F121 A124 Y148 G149 I150 H153 V241
BS02	U10	L	S178 F179 T182 L189 H190 L193 F216 Y222 S223 I224 G225 I229 L232	S178 F179 T182 L189 H190 L193 F216 Y222 S223 I224 G225 I229 L232
BS03	UQ1	L	W263 W265 W266	W263 W265 W266
BS04	BCL	L	F97 A124 I125 A127 L131 V157 Y162 F167 H168 H173 I177 F180 S244 M248	F97 A124 I125 A127 L131 V157 Y162 F167 H168 H173 I177 F180 S244 M248
BS05	BCL	L	I46 L131 F146 I150 W151 H153 L154	I46 L131 F146 I150 W151 H153 L154
BS06	BPH	L	F181 L185 L189	F181 L185 L189
BS07	U10	L	F29 V31 G35 F39 W100 R103	F29 V31 G35 F39 W100 R103
BS08	BCL	L	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS09	FE	L	H190 H230	H190 H230

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pil, PDBe:7pil, PDBj:7pil
PDBsum	7pil
PubMed	34590677
UniProt	Q3J1A5\|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]