Structure of PDB 7pas Chain L

Receptor sequence

>7pasL (length=118) Species: 272634 (Mycoplasmoides pneumoniae M129)

LGIDIPNQKRIEIALTYIFGIGLSRSQAILKQANINPDKRVKDLTEEEFV
AIRNVASAYKIEGDLRREIALNIKHLSEIGAWRGLRHRKNLPVRGQRTRT
NARTRKGPRKTVANKKIE

3D structure

• PDB: 7pas Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: L
• Resolution: 16.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	Q12 K13 R14 I17 T20 Y21 F23 G24 I25 G26 S28 R29 Q31 K35 D42 K43 R44 Y63 K64 L69 E72 I73 N76 W86 R87 R90 H91 K93 L95 P96 V97 R98 G99 Q100 R101 T102 R103 T104 N105 A106 R107 T108 R109 K110 P112 R113 K114 V116 K119	Q8 K9 R10 I13 T16 Y17 F19 G20 I21 G22 S24 R25 Q27 K31 D38 K39 R40 Y59 K60 L65 E68 I69 N72 W82 R83 R86 H87 K89 L91 P92 V93 R94 G95 Q96 R97 T98 R99 T100 N101 A102 R103 T104 R105 K106 P108 R109 K110 V112 K115

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pas, PDBe:7pas, PDBj:7pas
• PDBsum: 7pas
• PubMed: 36171285
• UniProt: Q50297|RS13_MYCPN Small ribosomal subunit protein uS13 (Gene Name=rpsM)