Structure of PDB 7p17 Chain L

Receptor sequence

>7p17L (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAITFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 7p17 X-Ray structure of Rhodobacter sphaeroides reaction center with M197 Phe-His substitution clarifies properties of the mutant complex
• Chain: L
• Resolution: 2.22 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 A124 L131 V157 T160 F167 H168 H173 I177 F180 S244 M248	F97 A124 L131 V157 T160 F167 H168 H173 I177 F180 S244 M248
BS02	BCL	L	Y128 F146 H153 L154	Y128 F146 H153 L154
BS03	BPH	L	F181 L185 L189	F181 L185 L189
BS04	BPH	L	I49 W100 E104 F121 A124 Y148 G149 H153 V241	I49 W100 E104 F121 A124 Y148 G149 H153 V241
BS05	U10	L	F29 G35 R103	F29 G35 R103
BS06	BCL	L	H168 M174 I177 T178 T182	H168 M174 I177 T178 T182
BS07	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7p17, PDBe:7p17, PDBj:7p17
• PDBsum: 7p17
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)