Structure of PDB 7okx Chain L

Receptor sequence

>7okxL (length=44) Species: 9823 (Sus scrofa) [Search protein sequence]

MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

3D structure

PDB

7okx Allosteric transcription stimulation by RNA polymerase II super elongation complex.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	L	C19 C22 C36	C5 C8 C22

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II

	Cellular Component
GO:0005634	nucleus
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005736	RNA polymerase I complex

External links