Structure of PDB 7ohs Chain L

Receptor sequence
>7ohsL (length=108) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAPTVKYNRKVRA
GRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQS
KIIVFPRN
3D structure
PDB7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
ChainL
Resolution4.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L Q28 K31 K32 R35 R36 R39 R42 L53 R55 V58 R59 P61 T62 V63 K64 Y65 K68 R70 G72 R73 L77 R91 D98 H99 R100 R101 R104 Q7 K10 K11 R14 R15 R18 R21 L32 R34 V37 R38 P40 T41 V42 K43 Y44 K47 R49 G51 R52 L56 R70 D77 H78 R79 R80 R83
BS02 rna L F26 D27 S34 F5 D6 S13
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
PDBsum7ohs
PubMed34813592
UniProtQ12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]