Structure of PDB 7ohr Chain L

Receptor sequence

>7ohrL (length=118) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

NHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAP
TVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDA
NVQRLKEYQSKIIVFPRN

3D structure

PDB

7ohr Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

4.72 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	N12 H13 F14 R15 K16 W18 K23 Q28 A29 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 V63 Y65 K68 R70 G72 R73 R91 D98 H99 R100 R101 Q102 R104 N105 R128	N1 H2 F3 R4 K5 W7 K12 Q17 A18 K20 K21 R24 R25 R28 R31 R44 V47 R48 P50 T51 V52 Y54 K57 R59 G61 R62 R80 D87 H88 R89 R90 Q91 R93 N94 R117
BS02	rna	L	F26 D27	F15 D16

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ohr, PDBe:7ohr, PDBj:7ohr
PDBsum	7ohr
PubMed	34813592
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]