Structure of PDB 7ohq Chain L

Receptor sequence

>7ohqL (length=187) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPV
VRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQE
IFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPATDVEAR
AVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

PDB

7ohq Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L10 K11 N12 H13 F14 R15 K16 H17 W18 Q19 K23 Q28 K31 K32 R35 R36 R39 R42 L53 R55 V58 R59 P61 T62 V63 Y65 K68 R70 G72 R73 K81 T86 R91 D98 H99 R100 R101 R104 N105 R128 R171 R174 S175 K178 F179 R186	L3 K4 N5 H6 F7 R8 K9 H10 W11 Q12 K16 Q21 K24 K25 R28 R29 R32 R35 L46 R48 V51 R52 P54 T55 V56 Y58 K61 R63 G65 R66 K74 T79 R84 D91 H92 R93 R94 R97 N98 R121 R164 R167 S168 K171 F172 R179

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ohq, PDBe:7ohq, PDBj:7ohq
PDBsum	7ohq
PubMed	34813592
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]