Structure of PDB 7oe0 Chain L

Receptor sequence

>7oe0L (length=123) Species: 679895 (Escherichia coli BW25113)

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

• PDB: 7oe0 RbfA Is Involved in Two Important Stages of 30S Subunit Assembly: Formation of the Central Pseudoknot and Docking of Helix 44 to the Decoding Center.
• Chain: L
• Resolution: 2.69 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	N4 Q5 L6 R8 R11 A12 R13 K17 A25 C26 P27 Q28 K29 R30 K42 N45 S46 R49 K50 T57 Y65 G67 G68 E69 R82 G83 V86 K87 P90 G91 R109 K110 Q111 A112 R113 S114 K115 G117 V118 K119 R120	N4 Q5 L6 R8 R11 A12 R13 K17 A25 C26 P27 Q28 K29 R30 K42 N45 S46 R49 K50 T57 Y65 G67 G68 E69 R82 G83 V86 K87 P90 G91 R109 K110 Q111 A112 R113 S114 K115 G117 V118 K119 R120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0034336 misfolded RNA binding

Biological Process

• GO:0000372 Group I intron splicing
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0033120 positive regulation of RNA splicing
• GO:0034337 RNA folding
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oe0, PDBe:7oe0, PDBj:7oe0
• PDBsum: 7oe0
• PubMed: 34200244
• UniProt: P0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)