Structure of PDB 7ode Chain L

Receptor sequence

>7odeL (length=183) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

MIGLVGKKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKDLANDGYRAIQV
TTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLAEGEEFTVGQSISVEL
FADVKKVDVTGTSKGKGFAGTVKRWNFKVFKGKKMAGQMGNERVTVQSLD
VVRVDAERNLLLVKGAVPGATGSDLIVKPAVKA

3D structure

PDB

7ode Structural Consequences of Deproteinating the 50S Ribosome.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	M11 T12 P23 Q36 N42 D43 Y45 Q49 K56 R59 T61 K62 P63 G66 H67 K70 L79 E81 R83 S113 K114 G115 K116 G117 F118 G120 R124 K154 V155 K157 K159 M161 A162 Q164 R169 V170 T171 Q173 S174 A192 V193 P194 A196 T197 K208	M11 T12 P23 Q36 N42 D43 Y45 Q49 K56 R59 T61 K62 P63 G66 H67 K70 L79 E81 R83 S113 K114 G115 K116 G117 F118 G120 R124 K128 V129 K131 K133 M135 A136 Q138 R143 V144 T145 Q147 S148 A166 V167 P168 A170 T171 K182

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ode, PDBe:7ode, PDBj:7ode
PDBsum	7ode
PubMed	36358955
UniProt	P60438\|RL3_ECOLI Large ribosomal subunit protein uL3 (Gene Name=rplC)

[Back to BioLiP]