Structure of PDB 7o0x Chain L

Receptor sequence

>7o0xL (length=273) Species: 1379270 (Gemmatimonas phototrophica)

AMLSFEKKYRVRGGTLIGGDLFDFWFGPFYVGFFGVTTIFFVTLGTLLCV
WGAAMGPTWNLWQINIAPPDLKYGLGLAPLREGGLWQIITLCALGAFGSW
ALRQAEIARKLGMGMHIPWAYGGAILAYTTLVVIRPFLLGAWGHGFPYGI
FSHLDWVSNVGYQYLHFHYNPAHMIAVTFFFTNCLALAMHGSLILSVTNP
PKGTPTGTSEQENVFFRDLLGYSIGAIGIHRLGLFLAVGAAVWSAICIVI
SGPFWTQGWPEWWNWWLNLPIWK

3D structure

• PDB: 7o0x 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
• Chain: L
• Resolution: 2.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGW	L	N60 W62	N60 W62
BS02	BPH	L	V42 W100 Q104 A120 Y121 A124 Y148 I150 F180	V42 W100 Q104 A120 Y121 A124 Y148 I150 F180
BS03	BCL	L	F97 A124 A127 L131 V157 V160 Y162 F167 H168 H173 V177 F180 S244 I248	F97 A124 A127 L131 V157 V160 Y162 F167 H168 H173 V177 F180 S244 I248
BS04	BCL	L	F146 I150 F151 H153 L154	F146 I150 F151 H153 L154
BS05	MQ8	L	V36 F40 L91 L94	V36 F40 L91 L94
BS06	0V9	L	N60 L61	N60 L61
BS07	FE	L	H190 H230	H190 H230
BS08	BCL	L	H168 M174 V177 T178 T182 L185	H168 M174 V177 T178 T182 L185
BS09	BPH	L	F181 C184	F181 C184
BS10	MQ8	L	F26 F29 I39	F26 F29 I39
BS11	V7B	L	T58 W59	T58 W59

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:7o0x, PDBe:7o0x, PDBj:7o0x
• PDBsum: 7o0x
• PubMed: 35171663
• UniProt: A0A143BHR2