Structure of PDB 7o0v Chain L

Receptor sequence

>7o0vL (length=273) Species: 1379270 (Gemmatimonas phototrophica)

AMLSFEKKYRVRGGTLIGGDLFDFWFGPFYVGFFGVTTIFFVTLGTLLCV
WGAAMGPTWNLWQINIAPPDLKYGLGLAPLREGGLWQIITLCALGAFGSW
ALRQAEIARKLGMGMHIPWAYGGAILAYTTLVVIRPFLLGAWGHGFPYGI
FSHLDWVSNVGYQYLHFHYNPAHMIAVTFFFTNCLALAMHGSLILSVTNP
PKGTPTGTSEQENVFFRDLLGYSIGAIGIHRLGLFLAVGAAVWSAICIVI
SGPFWTQGWPEWWNWWLNLPIWK

3D structure

• PDB: 7o0v 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
• Chain: L
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGW	L	N60 W62	N60 W62
BS02	MQ8	L	F40 F41 L91 L94 G122 G123 T129	F40 F41 L91 L94 G122 G123 T129
BS03	BCL	L	F146 I150 F151 H153 L154	F146 I150 F151 H153 L154
BS04	V7B	L	L47 P57 T58 W59	L47 P57 T58 W59
BS05	BPH	L	V42 W100 Q104 A120 Y121 A124 Y148 I150	V42 W100 Q104 A120 Y121 A124 Y148 I150
BS06	BCL	L	F97 A124 A127 L131 V157 V160 Y162 F167 H168 H173 V177 F180 S244 I248	F97 A124 A127 L131 V157 V160 Y162 F167 H168 H173 V177 F180 S244 I248
BS07	FE	L	H190 H230	H190 H230
BS08	BPH	L	F181 C184 M189	F181 C184 M189
BS09	MQ8	L	F26 F29 I39 R103	F26 F29 I39 R103
BS10	BCL	L	M174 V177 T178	M174 V177 T178

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:7o0v, PDBe:7o0v, PDBj:7o0v
• PDBsum: 7o0v
• PubMed: 35171663
• UniProt: A0A143BHR2