Structure of PDB 7mha Chain L

Receptor sequence

>7mhaL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 7mha Photosynthetic reaction center variants made via genetic code expansion indicate tyrosine at M210 tunes the mechanism for primary electron transfer
• Chain: L
• Resolution: 2.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F146 H153 L154	F146 H153 L154
BS02	BPH	L	A96 W100 E104 A120 F121 Y148 V241	A96 W100 E104 A120 F121 Y148 V241
BS03	U10	L	L189 H190 L193 E212 F216 S223 I224 G225 I229	L189 H190 L193 E212 F216 S223 I224 G225 I229
BS04	BCL	L	F97 A124 A127 L131 V157 T160 H168 H173 I177 F180 S244 M248	F97 A124 A127 L131 V157 T160 H168 H173 I177 F180 S244 M248
BS05	BPH	L	F181 L185 L189	F181 L185 L189
BS06	BCL	L	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS07	FE	L	H190 H230	H190 H230

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:7mha, PDBe:7mha, PDBj:7mha
• PDBsum: 7mha
• UniProt: Q3J1A5|RCEL_CERS4 Reaction center protein L chain (Gene Name=pufL)