Structure of PDB 7m4y Chain L

Receptor sequence

>7m4yL (length=137) Species: 480119 (Acinetobacter baumannii AB0057)

MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTARQIEAA
RRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPG
KILYEIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM

3D structure

• PDB: 7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
• Chain: L
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	K5 R6 K8 F9 R10 V12 H13 K14 G15 R16 R23 G24 R45 Q46 R52 R56 K63 R67 F69 E80 R82 M83 G84 N85 G86 K87 L120 A123 K124 P126 K128	K5 R6 K8 F9 R10 V12 H13 K14 G15 R16 R23 G24 R45 Q46 R52 R56 K63 R67 F69 E80 R82 M83 G84 N85 G86 K87 L120 A123 K124 P126 K128
BS02	rna	L	T18 R39	T18 R39

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
• PDBsum: 7m4y
• PubMed: 34044590
• UniProt: B7IA32|RL16_ACIB5 Large ribosomal subunit protein uL16 (Gene Name=rplP)