Structure of PDB 7kux Chain L

Receptor sequence

>7kuxL (length=160) Species: 3218 (Physcomitrium patens) [Search protein sequence]

QVIEPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVAPLLRGVEIGL
AHGYLLVGPFVLAGPLRNSAVRGEAGSLAAAGLVAILTMCLTIYGIASFK
EGEASKAPSLTLTGRQKAADKLQTAEGWAGFTGGFFFGGLSGVAWAYILL
YVLNLPYPVK

3D structure

PDB

7kux The structure of the Physcomitrium patens photosystem I reveals a unique Lhca2 paralogue replacing Lhca4.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	T81 V83 T84 I89 Y92	T17 V19 T20 I25 Y28
BS02	CLA	L	P123 F124 A127	P59 F60 A63
BS03	CLA	L	I67 L79 T81 P82	I3 L15 T17 P18
BS04	CLA	L	H116 L151	H52 L87
BS05	CLA	L	I150 Y158	I86 Y94
BS06	CLA	L	P129 L142 A143 G146 M153	P65 L78 A79 G82 M89
BS07	CLA	L	Y92 N95 L96 E111 L114	Y28 N31 L32 E47 L50
BS08	CLA	L	V83 Y92 P97 A98 I112 A115 H116 L119	V19 Y28 P33 A34 I48 A51 H52 L55
BS09	CLA	L	Y118 G122 P123 L126 L214 Y221	Y54 G58 P59 L62 L150 Y157

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7kux, PDBe:7kux, PDBj:7kux
PDBsum	7kux
PubMed	35190662
UniProt	A0A2K1KIF2

[Back to BioLiP]