Structure of PDB 7eu1 Chain L

Receptor sequence
>7eu1L (length=45) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
PVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR
3D structure
PDB7eu1 Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
ChainL
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN L C15 C32 C9 C26
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000418 RNA polymerase IV complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eu1, PDBe:7eu1, PDBj:7eu1
PDBsum7eu1
PubMed34941388
UniProtQ9FLM8|NRPBC_ARATH DNA-directed RNA polymerases II, IV and V subunit 12 (Gene Name=NRPB12)

[Back to BioLiP]