Structure of PDB 7dz7 Chain L

Receptor sequence

>7dz7L (length=159) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

KKAQVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVE
IGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGS
AQFQSTPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYV
CTQILPYYS

3D structure

PDB

7dz7 Structural basis of LhcbM5-mediated state transitions in green algae.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	T57 V59	T20 V22
BS02	CLA	L	P99 F100 L103 P105	P62 F63 L66 P68
BS03	CLA	L	P105 S120 L126 E179	P68 S83 L89 E142
BS04	CLA	L	L130 C131 I134	L93 C94 I97
BS05	CLA	L	N71 E87 L90	N34 E50 L53
BS06	CLA	L	Y68 P73 A74 I88 H92 L95	Y31 P36 A37 I51 H55 L58
BS07	CLA	L	F94 L95 G98 P99 K102 L103 Y195 S196	F57 L58 G61 P62 K65 L66 Y158 S159
BS08	CLA	L	L192 P193 Y194	L155 P156 Y157

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7dz7, PDBe:7dz7, PDBj:7dz7
PDBsum	7dz7
PubMed	34239095
UniProt	A8IL32

[Back to BioLiP]