Structure of PDB 7dug Chain L

Receptor sequence

>7dugL (length=124) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

PDB

7dug Crystal structure of the Thermus thermophilus (HB8) 30S ribosomal subunit with mRNA and cognate transfer RNA anticodon stem-loop and sisomicin derivative N1''TFMS bound

Chain

Resolution

3.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P5 T6 N8 Q9 L10 R12 K13 R15 E16 K17 R19 K20 K21 G29 A30 P31 F32 R33 R34 K46 K47 N49 S50 A51 L52 R53 K54 K57 T61 Y69 G72 E73 R86 K91 X92 P94 G95 R97 R113 K114 K115 S116 R117 S118 K119 T122 K123 K124	P1 T2 N4 Q5 L6 R8 K9 R11 E12 K13 R15 K16 K17 G25 A26 P27 F28 R29 R30 K42 K43 N45 S46 A47 L48 R49 K50 K53 T57 Y65 G68 E69 R82 K87 X88 P90 G91 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7dug, PDBe:7dug, PDBj:7dug
PDBsum	7dug
PubMed
UniProt	Q5SHN3\|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]