Structure of PDB 7c9r Chain L

Receptor sequence

>7c9rL (length=272) Species: 631362 (Thiorhodovibrio frisius)

ALLNFEKKYRVRGGTLVGGDLFDFWVGPFYVGFFGVSAVFFATLGTMLIL
FGAAIGPTLNIWQISIAPPDLSVGLGFAPIREGGLWQVITICAVGAFVSW
ALRQVEIARKLGMGLHVPFAFSFAILAYLTLVFFRPVLLGAWGHAFPYGL
FSHLDWVSNVGYQTLHFHYNPAHMLAISFFFINTLALAMHGSLILSVVNP
QKGEEVKTAEHENTVFRDIVGYSIGALAIHRLGLFLAINAAFWSAVCMIL
TGPFWTRGWPEWWMWWPNLPIW

3D structure

• PDB: 7c9r Cryo-EM structure of a Ca 2+ -bound photosynthetic LH1-RC complex containing multiple alpha beta-polypeptides.
• Chain: L
• Resolution: 2.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F98 V158 F168 H169 H174 I178 S245 M249	F97 V157 F167 H168 H173 I177 S244 M248
BS02	BPH	L	W101 Q105 F122 A238 A242	W100 Q104 F121 A237 A241
BS03	UQ8	L	F180 I183 H191 L194 F217 S224 I225 G226	F179 I182 H190 L193 F216 S223 I224 G225
BS04	BCL	L	F147 F152 H154 L155	F146 F151 H153 L154
BS05	UQ8	L	W87 Q88 T91 I92 F134 W143	W86 Q87 T90 I91 F133 W142
BS06	FE	L	H191 H231	H190 H230
BS07	BCL	L	I178 S179	I177 S178
BS08	BPH	L	F182 T185 L186	F181 T184 L185
BS09	MQ8	L	F30 V40 W101	F29 V39 W100

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:7c9r, PDBe:7c9r, PDBj:7c9r
• PDBsum: 7c9r
• PubMed: 33009385
• UniProt: G1BIY6