Structure of PDB 7c79 Chain L

Receptor sequence
>7c79L (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
EMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLF
SSRRLQAKRLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLG
CTLVTLLANVRALYMRLWEINETEFIRCGCL
3D structure
PDB7c79 Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
ChainL
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L H23 R24 K26 N27 R30 E40 R43 Q47 R80 Q81 W87 H21 R22 K24 N25 R28 E38 R41 Q45 R78 Q79 W85
Gene Ontology
Molecular Function
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c79, PDBe:7c79, PDBj:7c79
PDBsum7c79
PubMed32586950
UniProtQ12530|RMP1_YEAST Ribonuclease MRP protein subunit RMP1 (Gene Name=RMP1)

[Back to BioLiP]