Structure of PDB 7bg9 Chain L |
>7bg9L (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
RSSRAGLQFPVGRVRRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELA GNAARDNKKTRIIPRHLQLAIRNDEELNKLLG |
|
PDB | 7bg9 Structure of human telomerase holoenzyme with bound telomeric DNA. |
Chain | L |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
L |
R30 R78 R82 |
R13 R61 R65 |
|
|
|
|