Structure of PDB 7a18 Chain L

Receptor sequence
>7a18L (length=104) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG
3D structure
PDB7a18 Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
ChainL
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L L11 T13 R14 R15 V17 R18 T21 R26 F89 R91 Y96 L4 T6 R7 R8 V10 R11 T14 R19 F82 R84 Y89
BS02 rna L R28 Y32 S35 H37 Q41 G48 Q49 T50 A53 S55 N63 T65 Y94 K95 H97 R99 R21 Y25 S28 H30 Q34 G41 Q42 T43 A46 S48 N56 T58 Y87 K88 H90 R92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a18, PDBe:7a18, PDBj:7a18
PDBsum7a18
PubMed34417608
UniProtQ9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]