Structure of PDB 6zzx Chain L

Receptor sequence

>6zzxL (length=157) Species: 2649997 (Chlorella ohadii) [Search protein sequence]

KVQVVQPVNGDPFIGMLETPVTSSPAIAWYLSNLPAYRTGVSPLLRGVEI
GLAHGYLLVGPFIKLGPLRDVENVAEIVGCINGAATVLILTLCLAYGAVT
FQGEGPQVGVKTLSGRSIPRDPLQSADGWNKFTAGFAVGGLSGAAWGYLC
TQILPYY

3D structure

PDB

6zzx Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	V299 T313	V5 T19
BS02	CLA	L	M310 T313 V315 T316	M16 T19 V21 T22
BS03	CLA	L	P355 F356 L359 P361 R363	P61 F62 L65 P67 R69
BS04	CLA	L	L382 Y390	L88 Y96
BS05	CLA	L	P361 I371 I375 A378	P67 I77 I81 A84
BS06	CLA	L	N367 I371	N73 I77
BS07	CLA	L	Y324 N327 E343 A347	Y30 N33 E49 A53
BS08	CLA	L	Y324 P329 E343 I344 H348	Y30 P35 E49 I50 H54
BS09	CLA	L	Y350 L351 G354 P355 I357 K358 Y451	Y56 L57 G60 P61 I63 K64 Y157
BS10	CLA	L	L448 Y450 Y451	L154 Y156 Y157

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zzx, PDBe:6zzx, PDBj:6zzx
PDBsum	6zzx
PubMed	34462576
UniProt	A0A2P6TC44

[Back to BioLiP]