Structure of PDB 6zoo Chain L

Receptor sequence

>6zooL (length=159) Species: 3888 (Pisum sativum) [Search protein sequence]

YQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPGYRTAVNPLLRGIEVG
LAHGFLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSICLTIYGISSF
NEGDPSTAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAFFL
LYVLDLPYF

3D structure

PDB

6zoo Structure of plant photosystem I-plastocyanin complex reveals strong hydrophobic interactions.

Chain

Resolution

2.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	V57 P72	V4 P19
BS02	CLA	L	T71 V73 T74 L83	T18 V20 T21 L30
BS03	CLA	L	P113 F114 A117 P119 R121	P60 F61 A64 P66 R68
BS04	CLA	L	P119 A129 G136	P66 A76 G83
BS05	CLA	L	Y82 N85 R90 E101 L104 A105	Y29 N32 R37 E48 L51 A52
BS06	CLA	L	Y82 P87 V102 H106 L109	Y29 P34 V49 H53 L56
BS07	CLA	L	F108 L109 G112 P113 K116 L204 Y211 F212	F55 L56 G59 P60 K63 L151 Y158 F159

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009535	chloroplast thylakoid membrane
GO:0009538	photosystem I reaction center
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zoo, PDBe:6zoo, PDBj:6zoo
PDBsum	6zoo
PubMed	34085703
UniProt	E1C9L1

[Back to BioLiP]