Structure of PDB 6zmw Chain L

Receptor sequence
>6zmwL (length=220) Species: 9606 (Homo sapiens) [Search protein sequence]
DKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEV
LKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAII
LAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVS
APVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLW
KETVFTKSPYQEFTDHLVKT
3D structure
PDB6zmw Structure of a human 48Stranslational initiation complex.
ChainL
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L V112 Q113 K114 Q115 R117 R123 K125 K145 T185 R187 C188 G189 S190 R194 I196 V205 S206 Y223 T224 A226 C229 T232 N235 V56 Q57 K58 Q59 R61 R67 K69 K89 T129 R131 C132 G133 S134 R138 I140 V149 S150 Y167 T168 A170 C173 T176 N179
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0017134 fibroblast growth factor binding
GO:0019899 enzyme binding
GO:0045296 cadherin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0051443 positive regulation of ubiquitin-protein transferase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zmw, PDBe:6zmw, PDBj:6zmw
PDBsum6zmw
PubMed32883864
UniProtP15880|RS2_HUMAN Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]