Structure of PDB 6zi6 Chain L
Receptor sequence
| >6zi6L (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence] |
| ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA SGPFWTRGWPEWWGWWLDIPFWS |
3D structure
| PDB | 6zi6 Ultrafast structural changes within a photosynthetic reaction centre. | ||
| Chain | L | ||
| Resolution | 2.8 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | BCB | L | F97 P124 M127 F128 V157 F160 Y162 W167 H168 H173 S176 V177 F241 G244 T248 | F97 P124 M127 F128 V157 F160 Y162 W167 H168 H173 S176 V177 F241 G244 T248 | |
| BS02 | BCB | L | F128 F146 I150 H153 L154 V157 | F128 F146 I150 H153 L154 V157 | |
| BS03 | BPB | L | I42 I49 W100 E104 A120 F121 P124 Y148 A237 F241 | I42 I49 W100 E104 A120 F121 P124 Y148 A237 F241 | |
| BS04 | BCB | L | M174 V177 S178 F181 | M174 V177 S178 F181 | |
| BS05 | BPB | L | F181 M185 L189 V220 | F181 M185 L189 V220 | |
| BS06 | FE | L | H190 H230 | H190 H230 | |
| BS07 | MQ7 | L | Y29 W100 | Y29 W100 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0042314 | bacteriochlorophyll binding |
| GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity |
| GO:0046872 | metal ion binding |
