Structure of PDB 6wj6 Chain L

Receptor sequence
>6wj6L (length=31) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
RQPVELNRTSLYLGLLLVAVLGILFSSYFFN
3D structure
PDB6wj6 Cryo-EM Structure of Monomeric Photosystem II from Synechocystis sp. PCC 6803 Lacking the Water-Oxidation Complex
ChainL
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide L L14 L19 G22 V26 L29 F37 F38 L6 L11 G14 V18 L21 F29 F30
BS02 peptide L R16 T17 Y20 L24 A27 I31 F38 R8 T9 Y12 L16 A19 I23 F30
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wj6, PDBe:6wj6, PDBj:6wj6
PDBsum6wj6
PubMed
UniProtQ55354|PSBL_SYNY3 Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]