Structure of PDB 6w6v Chain L

Receptor sequence
>6w6vL (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIIT
LFSRLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVT
LLANVRALYMRLWEINETEFI
3D structure
PDB6w6v Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
ChainL
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L R24 N27 G36 N39 E40 K42 R43 R80 Q81 R84 W87 R24 N27 G36 N39 E40 K42 R43 R73 Q74 R77 W80
Gene Ontology
Molecular Function
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6v, PDBe:6w6v, PDBj:6w6v
PDBsum6w6v
PubMed32651392
UniProtQ12530|RMP1_YEAST Ribonuclease MRP protein subunit RMP1 (Gene Name=RMP1)

[Back to BioLiP]