Structure of PDB 6v3d Chain L

Receptor sequence
>6v3dL (length=137) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTARQIEAA
RRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPG
KILYEIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM
3D structure
PDB6v3d Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
ChainL
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L K5 R6 F9 K11 V12 H13 K14 G15 R16 N17 R23 G24 F29 R45 Q46 R52 F69 E76 R82 M83 G84 N85 G86 K87 K124 K128 K5 R6 F9 K11 V12 H13 K14 G15 R16 N17 R23 G24 F29 R45 Q46 R52 F69 E76 R82 M83 G84 N85 G86 K87 K124 K128
BS02 rna L T18 R39 T18 R39
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v3d, PDBe:6v3d, PDBj:6v3d
PDBsum6v3d
PubMed31964740
UniProtB7IA32|RL16_ACIB5 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]