Structure of PDB 6uzv Chain L

Receptor sequence

>6uzvL (length=153) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]

NQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVG
MAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTF
QGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRG
LFN

3D structure

PDB

6uzv The structure of a red-shifted photosystem I reveals a red site in the core antenna.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	V8 I24	V4 I20
BS02	CLA	L	P64 W65 L68	P60 W61 L64
BS03	CLA	L	T22 I24 S25 I34	T18 I20 S21 I30
BS04	CLA	L	W65 P70 I83 A87	W61 P66 I79 A83
BS05	CLA	L	V91 Y99	V87 Y95
BS06	CLA	L	N36 L37 R41 E52 M55	N32 L33 R37 E48 M51
BS07	CLA	L	L37 P38 A39 V53 A56 H57 F60	L33 P34 A35 V49 A52 H53 F56
BS08	CLA	L	Y59 F60 G63 P64 L67 L141 L142 L145 F152	Y55 F56 G59 P60 L63 L137 L138 L141 F148
BS09	CA	L	P70 D73	P66 D69
BS10	CLA	L	I151 N157	I147 N153
BS11	CLA	L	A94 S97	A90 S93

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0005886	plasma membrane
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6uzv, PDBe:6uzv, PDBj:6uzv
PDBsum	6uzv
PubMed	33077842
UniProt	P37277\|PSAL_SYNY3 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]