Structure of PDB 6u9h Chain L

Receptor sequence

>6u9hL (length=582) Species: 3702 (Arabidopsis thaliana)

TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSS
IRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLD
SVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRII
EEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPE
DSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGL
GSYPCDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAF
ASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKL
DFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGV
GQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDI
DGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAH
TFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLDTPGPY
LLDVICPHQEHVLPMIPSGGTFNDVITEGDGR

3D structure

• PDB: 6u9h Structures of fungal and plant acetohydroxyacid synthases.
• Chain: L
• Resolution: 3.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y118 G120 G121 A122 S123 E144 T167 F206 Q207 E208 K256 M351 V378 V485 G511 M513 D538 N565 H567 L568 M570 V571 W574
• Catalytic site (residue number reindexed from 1): Y33 G35 G36 A37 S38 E59 T82 F121 Q122 E123 K171 M266 V293 V400 G426 M428 D453 N480 H482 L483 M485 V486 W489
• Enzyme Commision number: 2.2.1.6: acetolactate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	L	G537 D538	G452 D453
BS02	FAD	L	D185 S186 R246 G308 G309 T331 L332 M333 M348 L349 G350 M351 H352 G371 V372 R373 D375 R377 V378 D395 I396 E400 V415 M490 G508	D100 S101 R161 G223 G224 T246 L247 M248 M263 L264 G265 M266 H267 G286 V287 R288 D290 R292 V293 D310 I311 E315 V330 M405 G423
BS03	TPP	L	V485 Q487 H488 G511 M513 G537 D538 G539 S540 M543 L568 G569 M570 V571	V400 Q402 H403 G426 M428 G452 D453 G454 S455 M458 L483 G484 M485 V486
BS04	TPP	L	Y118 E144 T167 P170 G171 Q207	Y33 E59 T82 P85 G86 Q122

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003824 catalytic activity
• GO:0003984 acetolactate synthase activity
• GO:0030976 thiamine pyrophosphate binding
• GO:0050660 flavin adenine dinucleotide binding

Biological Process

• GO:0009082 branched-chain amino acid biosynthetic process

External links

• PDB: RCSB:6u9h, PDBe:6u9h, PDBj:6u9h
• PDBsum: 6u9h
• PubMed: 32640464
• UniProt: P17597|ILVB_ARATH Acetolactate synthase, chloroplastic (Gene Name=ALS)