Structure of PDB 6tnp Chain L |
>6tnpL (length=112) Species: 10090 (Mus musculus) [Search protein sequence] |
LVMTQSPSSLTVTAGEKVTMICKSSQSLLNSGDQKNYLTWYQQKPGQPPK LLIFWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYP LTFGAGTKLELK |
|
PDB | 6tnp Structural characterization of an unprecedented lectin-like antitumoral anti-MUC1 antibody. |
Chain | L |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NO8 |
L |
Y98 Y100 |
Y97 Y99 |
|
|
|