Structure of PDB 6tmf Chain L

Receptor sequence

>6tmfL (length=132) Species: 1293037 (Thermococcus celer Vu 13 = JCM 8558) [Search protein sequence]

MKVIQTAGKRKTAIARATIREGKGRVRINHRPVEIIEPEIARFTIMEPLV
LAGEEIVKGVDIDVKVEGGGFMGQAEAARVAIARALVEWTNDMNLKEKFM
KYDRTMLVGDSRRTEPHKPNRSTKGPRAKRQK

3D structure

PDB

6tmf Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	Q5 K9 R10 K11 T12 R16 R20 R27 H30 G68 G69 G70 M72 Q74 R104 V108 R112 R113 T114 E115 P116 H117 K118 P119 R121 S122 T123 K124 G125 P126 R127 A128 K129 Q131 K132	Q5 K9 R10 K11 T12 R16 R20 R27 H30 G68 G69 G70 M72 Q74 R104 V108 R112 R113 T114 E115 P116 H117 K118 P119 R121 S122 T123 K124 G125 P126 R127 A128 K129 Q131 K132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links