Structure of PDB 6spd Chain L

Receptor sequence

>6spdL (length=143) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

QLNDLRSAPGARREKHRPGRGIGSGLGKTGGRGHKGLTSRSGGKVAPGFE
GGQQPLHRRLPKFGFVSLKAMDRAEVRTSELAKVEGDVVSLQTLKDANLI
NQHVQRVKVMLSGEVGRAVTLKGIAATKGARAAIEAAGGKFED

3D structure

PDB

6spd Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.

Chain

Resolution

3.28 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	L3 N4 R7 G11 R13 R14 R18 P19 G20 R21 G22 G24 K29 G32 R33 G34 K36 L38 R41 S42 G43 K45 F50 E51 G52 G53 Q54 R60 P62 K63 F64 F66 K70 R78 E81 N99 Q103 R107 K109 M111 L112 T128 K129	L2 N3 R6 G10 R12 R13 R17 P18 G19 R20 G21 G23 K28 G31 R32 G33 K35 L37 R40 S41 G42 K44 F49 E50 G51 G52 Q53 R59 P61 K62 F63 F65 K69 R77 E80 N98 Q102 R106 K108 M110 L111 T127 K128

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links