Structure of PDB 6sl5 Chain L

Receptor sequence
>6sl5L (length=155) Species: 3046 (Dunaliella salina) [Search protein sequence]
QQVIQPLNGDPFVGMLETPVTSAPIVANYLSNLPAYRTGVAPNLRGVEIG
LAHGFLLAGPFIKLGPLRDVPGTAEVVGCMSAALVLILALCLSLYGNAAF
QNQPSMGKKTLSGRPLPQDPLMSEEGWAKFAAGFTVGGLSGVAWAYILTQ
VCLGR
3D structure
PDB6sl5 Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.
ChainL
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L I57 P72 I4 P19
BS02 CLA L T71 V73 T74 V79 T18 V20 T21 V26
BS03 CLA L P113 L117 P60 L64
BS04 CLA L P119 C132 M133 A136 P66 C79 M80 A83
BS05 CLA L H106 L110 L141 H53 L57 L88
BS06 CLA L I140 Y148 I87 Y95
BS07 CLA L N85 E101 A105 N32 E48 A52
BS08 CLA L Y82 P87 H106 L109 Y29 P34 H53 L56
BS09 CLA L C205 L206 R208 C152 L153 R155
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 21:00:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6sl5', asym_id = 'L', title = 'Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6sl5', asym_id='L', title='Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '6sl5', asym_id = 'L'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='6sl5', asym_id='L')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>