Structure of PDB 6rw4 Chain L

Receptor sequence

>6rw4L (length=174) Species: 9606 (Homo sapiens) [Search protein sequence]

LDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFM
KKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQ
RKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIR
VFQETQKLKKRRRALKAAAAAQKQ

3D structure

PDB

6rw4 Distinct pre-initiation steps in human mitochondrial translation.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	N99 K100 K101 R123 R128 K135 Y139 H142 H146 D149 K150 H152 K153 R154 Y155 M158 S159 D161 Q162 K165 K168 Y195 Y196 R197 R198 H200 R201 R202 F203 K206 K207 C210 F214	N37 K38 K39 R61 R66 K73 Y77 H80 H84 D87 K88 H90 K91 R92 Y93 M96 S97 D99 Q100 K103 K106 Y133 Y134 R135 R136 H138 R139 R140 F141 K144 K145 C148 F152
BS02	NAD	L	L194 Y195 Y196	L132 Y133 Y134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6rw4, PDBe:6rw4, PDBj:6rw4
PDBsum	6rw4
PubMed	32522994
UniProt	P82914\|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)

[Back to BioLiP]