Structure of PDB 6rkd Chain L

Receptor sequence

>6rkdL (length=268) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRG
RAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQL
GSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPY
KLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTS
KDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPG
NLTRALAGEHVGTIITAS

3D structure

PDB

6rkd Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	J8E	L	P124 V126	P122 V124
BS02	J8E	L	S132 V134	S130 V132
BS03	MOO	L	S104 D108 S147	S102 D106 S145
BS04	ATP	L	K42 Q46 A78 G79 K189 D190 E191 L194 Y195 A197 N198 P199 K200 D223 I225	K40 Q44 A76 G77 K187 D188 E189 L192 Y193 A195 N196 P197 K198 D221 I223
BS05	8M0	L	G127 G128 A129 F146 S147 P151 K153 L176 F180	G125 G126 A127 F144 S145 P149 K151 L174 F178
BS06	MOO	L	A78 R83 R168	A76 R81 R166

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6rkd, PDBe:6rkd, PDBj:6rkd
PDBsum	6rkd
PubMed	31811022
UniProt	P84253\|MOSB_AZOVD Molybdenum storage protein subunit beta (Gene Name=mosB)

[Back to BioLiP]