Structure of PDB 6rbe Chain L

Receptor sequence

>6rbeL (length=155) Species: 559292 (Saccharomyces cerevisiae S288C)

STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYE
KRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANK
QFAKF

3D structure

• PDB: 6rbe Conformational proofreading of distant 40S ribosomal subunit maturation events by a long-range communication mechanism.
• Chain: L
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	A12 P17 H18 F20 V25 K26 T27 S28 W34 K36 N37 A38 G39 L40 K43 K56 K57 L63 S65 I66 R67 K69 K79 M80 Y90 H92 K96 Y97 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137 Q152 F153	A11 P16 H17 F19 V24 K25 T26 S27 W33 K35 N36 A37 G38 L39 K42 K55 K56 L62 S64 I65 R66 K68 K78 M79 Y89 H91 K95 Y96 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136 Q151 F152

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6rbe, PDBe:6rbe, PDBj:6rbe
• PDBsum: 6rbe
• PubMed: 31227701
• UniProt: P0CX47|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)