Structure of PDB 6ppn Chain L

Receptor sequence
>6ppnL (length=88) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
MLPLTLLNATQGRPILVELKNGETFNGHLENCDNYMNLTLREVIRTMPDG
DKFFRLPECYIRGNNIKYLRIQDEVLSQVAKQQAQQRE
3D structure
PDB6ppn Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
ChainL
Resolution1.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L Y35 N37 R62 Y35 N37 R62
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0030620 U2 snRNA binding
GO:0140691 RNA folding chaperone
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
GO:0034337 RNA folding
GO:1905323 telomerase holoenzyme complex assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005686 U2 snRNP
GO:0005688 U6 snRNP
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0097525 spliceosomal snRNP complex
GO:0097526 spliceosomal tri-snRNP complex
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppn, PDBe:6ppn, PDBj:6ppn
PDBsum6ppn
PubMed32518066
UniProtO14352|LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 (Gene Name=lsm4)

[Back to BioLiP]